PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_F326C5B8E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 98aa    MW: 11275.8 Da    PI: 9.9397
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_F326C5B8E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.83.9e-324197258
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                   WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
                           dDgy+WrKYGqK +k+s++prsYYrCt ++C++kk+ver+ ++p+++++tYeg H h
  Traes_3AL_F326C5B8E.1 41 DDGYKWRKYGQKAIKNSPNPRSYYRCTNPRCNAKKQVERAVDEPDTLVVTYEGLHLH 97
                           8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.3823598IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.3E-303597IPR003657WRKY domain
SuperFamilySSF1182903.27E-273897IPR003657WRKY domain
SMARTSM007741.8E-324097IPR003657WRKY domain
PfamPF031066.1E-264197IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
GRSKYHYSPS SPVVFSPEKV LGKMENKYTM KIKSCGNGLA DDGYKWRKYG QKAIKNSPNP  60
RSYYRCTNPR CNAKKQVERA VDEPDTLVVT YEGLHLHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2239971674Probable WRKY transcription factor 4
1wj2_A2e-2239971674Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703065e-70HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754265.12e-54PREDICTED: WRKY transcription factor SUSIBA2-like isoform X1
RefseqXP_014754266.11e-54PREDICTED: WRKY transcription factor SUSIBA2-like isoform X2
SwissprotQ9FHR74e-37WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLW5CI366e-69W5CI36_WHEAT; Uncharacterized protein
TrEMBLM0YZ589e-68M0YZ58_HORVD; Uncharacterized protein
STRINGMLOC_7470.13e-67(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-38WRKY DNA-binding protein 49
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]